Class b: All beta proteins [48724] (177 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.0: automated matches [191454] (1 protein) not a true family |
Protein automated matches [190698] (21 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [255015] (2 PDB entries) |
Domain d1zrya_: 1zry A: [125569] automated match to d1lida_ |
PDB Entry: 1zry (more details)
SCOPe Domain Sequences for d1zrya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zrya_ b.60.1.0 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} afsgtwqvyaqenyeeflkalalpedlikmardikpiveiqqkgddfvvtsktprqtvtn sftlgkeadittmdgkklkctvhlangklvtksekfsheqevkgnemvetitfggvtlir rskrv
Timeline for d1zrya_: