SCOPe 2.06: Domain d1zrya_: 1zry A:

Lineage for d1zrya_ (1zry A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.0: automated matches [191454] (1 protein)
   not a true family

6. Protein automated matches [190698] (21 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [255015] (2 PDB entries)

8. Domain d1zrya_: 1zry A: [125569]
   automated match to d1lida_

Details for d1zrya_

PDB Entry: 1zry

PDB Description: nmr structural analysis of apo chicken liver bile acid binding protein

PDB Compounds: (A:) Fatty acid-binding protein, liver

SCOPe Domain Sequences for d1zrya_:

Sequence; same for both SEQRES and ATOM records:

>d1zrya_ b.60.1.0 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
afsgtwqvyaqenyeeflkalalpedlikmardikpiveiqqkgddfvvtsktprqtvtn
sftlgkeadittmdgkklkctvhlangklvtksekfsheqevkgnemvetitfggvtlir
rskrv

Timeline for d1zrya_:

• d1zrya_ first appeared in SCOP 1.73, called d1zrya1
  
• d1zrya_ appears in SCOPe 2.05
  
• d1zrya_ appears in SCOPe 2.07
  
• d1zrya_ appears in the current release, SCOPe 2.08