![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
![]() | Superfamily b.60.1: Lipocalins [50814] (8 families) ![]() bind hydrophobic ligands in their interior |
![]() | Family b.60.1.2: Fatty acid binding protein-like [50847] (17 proteins) ten-stranded meander beta-sheet folded upon itself relates to the common fold by opening the barrel and insertion of beta-hairpin |
![]() | Protein Liver basic fatty acid binding protein, LB_FABP [89368] (3 species) |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [89369] (4 PDB entries) |
![]() | Domain d1zrya1: 1zry A:1-125 [125569] automatically matched to d1mvga_ |
PDB Entry: 1zry (more details)
SCOP Domain Sequences for d1zrya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zrya1 b.60.1.2 (A:1-125) Liver basic fatty acid binding protein, LB_FABP {Chicken (Gallus gallus) [TaxId: 9031]} afsgtwqvyaqenyeeflkalalpedlikmardikpiveiqqkgddfvvtsktprqtvtn sftlgkeadittmdgkklkctvhlangklvtksekfsheqevkgnemvetitfggvtlir rskrv
Timeline for d1zrya1: