SCOP 1.73: Domain d1zrya1: 1zry A:1-125

Lineage for d1zrya1 (1zry A:1-125)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (8 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (17 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein Liver basic fatty acid binding protein, LB_FABP [89368] (3 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [89369] (4 PDB entries)

8. Domain d1zrya1: 1zry A:1-125 [125569]
   automatically matched to d1mvga_

Details for d1zrya1

PDB Entry: 1zry

PDB Description: nmr structural analysis of apo chicken liver bile acid binding protein

PDB Compounds: (A:) Fatty acid-binding protein, liver

SCOP Domain Sequences for d1zrya1:

Sequence; same for both SEQRES and ATOM records:

>d1zrya1 b.60.1.2 (A:1-125) Liver basic fatty acid binding protein, LB_FABP {Chicken (Gallus gallus) [TaxId: 9031]}
afsgtwqvyaqenyeeflkalalpedlikmardikpiveiqqkgddfvvtsktprqtvtn
sftlgkeadittmdgkklkctvhlangklvtksekfsheqevkgnemvetitfggvtlir
rskrv

Timeline for d1zrya1:

• d1zrya1 is new in SCOP 1.73
  
• d1zrya1 appears in SCOP 1.75
  
• d1zrya1 appears in the current release, SCOPe 2.08, called d1zrya_