Lineage for d1zrya_ (1zry A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2805574Family b.60.1.0: automated matches [191454] (1 protein)
    not a true family
  6. 2805575Protein automated matches [190698] (25 species)
    not a true protein
  7. 2805589Species Chicken (Gallus gallus) [TaxId:9031] [255015] (2 PDB entries)
  8. 2805591Domain d1zrya_: 1zry A: [125569]
    automated match to d1lida_

Details for d1zrya_

PDB Entry: 1zry (more details)

PDB Description: nmr structural analysis of apo chicken liver bile acid binding protein
PDB Compounds: (A:) Fatty acid-binding protein, liver

SCOPe Domain Sequences for d1zrya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zrya_ b.60.1.0 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
afsgtwqvyaqenyeeflkalalpedlikmardikpiveiqqkgddfvvtsktprqtvtn
sftlgkeadittmdgkklkctvhlangklvtksekfsheqevkgnemvetitfggvtlir
rskrv

SCOPe Domain Coordinates for d1zrya_:

Click to download the PDB-style file with coordinates for d1zrya_.
(The format of our PDB-style files is described here.)

Timeline for d1zrya_: