SCOPe 2.08: Domain d1zruc3: 1zru C:2-140

Lineage for d1zruc3 (1zru C:2-140)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.163: Pseudo beta-prism I [141657] (1 superfamily)
   beta-sandwich with one regular beta-sheet and the other beta-sheet bent in the middle with a set of aligned beta-bulges

4. Superfamily b.163.1: Bacteriophage trimeric proteins domain [141658] (2 families)
   found in phage proteins that form trimers, but is not involved in the trimerisation

5. Family b.163.1.2: Lactophage receptor-binding protein N-terminal domain [141662] (1 protein)
   automatically mapped to Pfam PF08931

6. Protein Receptor binding protein, rbp, N-terminal domain [141663] (1 species)
   includes extra N-terminal trimerization helix

7. Species Lactococcus lactis phage p2 [TaxId:100641] [141664] (2 PDB entries)
   Uniprot Q71AW2 2-140

8. Domain d1zruc3: 1zru C:2-140 [125568]
   Other proteins in same PDB: d1zrua1, d1zrua2, d1zrub1, d1zrub2, d1zruc1, d1zruc2
   automated match to d1zrua3
   complexed with gol

Details for d1zruc3

PDB Entry: 1zru, 1.73 Å

PDB Description: structure of the lactophage p2 receptor binding protein in complex with glycerol

PDB Compounds: (C:) lactophage p2 receptor binding protein

SCOPe Domain Sequences for d1zruc3:

Sequence, based on SEQRES records:

>d1zruc3 b.163.1.2 (C:2-140) Receptor binding protein, rbp, N-terminal domain {Lactococcus lactis phage p2 [TaxId: 100641]}
tiknftffspnstefpvgsnndgklymmltgmdyrtirrkdwssplntalnvqytntsii
aggryfellnetvalkgdsvnyihanidltqtanpvslsaetannsngvdinngsgvlkv
cfdivttsgtgvtstkpiv

Sequence, based on observed residues (ATOM records):

>d1zruc3 b.163.1.2 (C:2-140) Receptor binding protein, rbp, N-terminal domain {Lactococcus lactis phage p2 [TaxId: 100641]}
tiknftffgsnndgklymmltgmdyrtirrkdwssplntalnvqytntsiiaggryfell
netvalkgdsvnyihanidltqtanpvslsaetannsngvdinngsgvlkvcfdivttsg
tgvtstkpiv

Timeline for d1zruc3:

• d1zruc3 first appeared in SCOP 1.73
  
• d1zruc3 appears in SCOPe 2.07