Lineage for d1zrub3 (1zru B:2-140)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 681023Fold b.163: Pseudo beta-prism [141657] (1 superfamily)
    beta-sandwich with one regular beta-sheet and the other beta-sheet bent in the middle with a set of aligned beta-bulges
  4. 681024Superfamily b.163.1: Bacteriophage trimeric proteins domain [141658] (2 families) (S)
    found in phage proteins that form trimers, but is not involved in the trimerisation
  5. 681035Family b.163.1.2: Lactophage receptor-binding protein N-terminal domain [141662] (1 protein)
  6. 681036Protein Receptor binding protein, rbp, N-terminal domain [141663] (1 species)
    includes extra N-terminal trimerization helix
  7. 681037Species Lactococcus lactis phage p2 [TaxId:100641] [141664] (2 PDB entries)
  8. 681039Domain d1zrub3: 1zru B:2-140 [125565]
    Other proteins in same PDB: d1zrua1, d1zrua2, d1zrub1, d1zrub2, d1zruc1, d1zruc2
    automatically matched to 1ZRU A:2-140
    complexed with gol

Details for d1zrub3

PDB Entry: 1zru (more details), 1.73 Å

PDB Description: structure of the lactophage p2 receptor binding protein in complex with glycerol
PDB Compounds: (B:) lactophage p2 receptor binding protein

SCOP Domain Sequences for d1zrub3:

Sequence, based on SEQRES records: (download)

>d1zrub3 b.163.1.2 (B:2-140) Receptor binding protein, rbp, N-terminal domain {Lactococcus lactis phage p2 [TaxId: 100641]}
tiknftffspnstefpvgsnndgklymmltgmdyrtirrkdwssplntalnvqytntsii
aggryfellnetvalkgdsvnyihanidltqtanpvslsaetannsngvdinngsgvlkv
cfdivttsgtgvtstkpiv

Sequence, based on observed residues (ATOM records): (download)

>d1zrub3 b.163.1.2 (B:2-140) Receptor binding protein, rbp, N-terminal domain {Lactococcus lactis phage p2 [TaxId: 100641]}
tiknfgsnndgklymmltgmdyrtirrkdwssplntalnvqytntsiiaggryfellnet
valkgdsvnyihanidltqtanpvslsaetannsngvdinngsgvlkvcfdivttsgtgv
tstkpiv

SCOP Domain Coordinates for d1zrub3:

Click to download the PDB-style file with coordinates for d1zrub3.
(The format of our PDB-style files is described here.)

Timeline for d1zrub3: