Lineage for d1zrua3 (1zru A:2-140)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.163: Pseudo beta-prism I [141657] (1 superfamily)
    beta-sandwich with one regular beta-sheet and the other beta-sheet bent in the middle with a set of aligned beta-bulges
  4. Superfamily b.163.1: Bacteriophage trimeric proteins domain [141658] (2 families) (S)
    found in phage proteins that form trimers, but is not involved in the trimerisation
  5. Family b.163.1.2: Lactophage receptor-binding protein N-terminal domain [141662] (1 protein)
    automatically mapped to Pfam PF08931
  6. Protein Receptor binding protein, rbp, N-terminal domain [141663] (1 species)
    includes extra N-terminal trimerization helix
  7. Species Lactococcus lactis phage p2 [TaxId:100641] [141664] (2 PDB entries)
    Uniprot Q71AW2 2-140
  8. Domain d1zrua3: 1zru A:2-140 [125562]
    Other proteins in same PDB: d1zrua1, d1zrua2, d1zrub1, d1zrub2, d1zruc1, d1zruc2
    complexed with gol

Details for d1zrua3

PDB Entry: 1zru (more details), 1.73 Å

PDB Description: structure of the lactophage p2 receptor binding protein in complex with glycerol
PDB Compounds: (A:) lactophage p2 receptor binding protein

SCOPe Domain Sequences for d1zrua3:

Sequence, based on SEQRES records: (download)

>d1zrua3 b.163.1.2 (A:2-140) Receptor binding protein, rbp, N-terminal domain {Lactococcus lactis phage p2 [TaxId: 100641]}
tiknftffspnstefpvgsnndgklymmltgmdyrtirrkdwssplntalnvqytntsii
aggryfellnetvalkgdsvnyihanidltqtanpvslsaetannsngvdinngsgvlkv
cfdivttsgtgvtstkpiv

Sequence, based on observed residues (ATOM records): (download)

>d1zrua3 b.163.1.2 (A:2-140) Receptor binding protein, rbp, N-terminal domain {Lactococcus lactis phage p2 [TaxId: 100641]}
tiknftfgsnndgklymmltgmdyrtirrkdwssplntalnvqytntsiiaggryfelln
etvalkgdsvnyihanidltqtanpvslsaetannsngvdinngsgvlkvcfdivttsgt
gvtstkpiv

SCOPe Domain Coordinates for d1zrua3 are not available.

Timeline for d1zrua3:

Domains from same chain:
(mouse over for more information)
d1zrua1, d1zrua2
Domains from other chains:
(mouse over for more information)
d1zrub1, d1zrub2, d1zrub3, d1zruc1, d1zruc2, d1zruc3