Class b: All beta proteins [48724] (178 folds) |
Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily) sandwich, 10 strands in 2 sheets; greek-key |
Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) |
Family b.21.1.3: Lactophage receptor-binding protein head domain [141122] (3 proteins) automatically mapped to Pfam PF08932 |
Protein receptor binding protein, rbp, C-terminal domain [141125] (1 species) |
Species Lactococcus lactis phage p2 [TaxId:100641] [141126] (3 PDB entries) Uniprot Q71AW2 162-264 |
Domain d1zrua1: 1zru A:162-264 [125560] Other proteins in same PDB: d1zrua2, d1zrua3, d1zrub2, d1zrub3, d1zruc2, d1zruc3 complexed with gol |
PDB Entry: 1zru (more details), 1.73 Å
SCOPe Domain Sequences for d1zrua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zrua1 b.21.1.3 (A:162-264) receptor binding protein, rbp, C-terminal domain {Lactococcus lactis phage p2 [TaxId: 100641]} pvqtltveagnglqlqltkknndlvivrffgsvsniqkgwnmsgtwvdrpfrpaavqslv ghfagrdtsfhidinpngsitwwganidktpiatrgngsyfik
Timeline for d1zrua1: