SCOPe 2.07: Domain d1zrsb2: 1zrs B:7-169

Lineage for d1zrsb2 (1zrs B:7-169)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.7: LD-carboxypeptidase A N-terminal domain-like [142074] (1 protein)
   N-terminal half of Pfam PF02016

6. Protein LD-carboxypeptidase A, N-terminal domain [142075] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [142076] (4 PDB entries)
   Uniprot Q9HTZ1 3-169! Uniprot Q9HTZ1 5-142! Uniprot Q9HTZ1 5-169

8. Domain d1zrsb2: 1zrs B:7-169 [125559]
   Other proteins in same PDB: d1zrsa1, d1zrsb1
   automated match to d1zrsa2

Details for d1zrsb2

PDB Entry: 1zrs, 1.5 Å

PDB Description: wild-type LD-carboxypeptidase

PDB Compounds: (B:) hypothetical protein

SCOPe Domain Sequences for d1zrsb2:

Sequence, based on SEQRES records:

>d1zrsb2 c.23.16.7 (B:7-169) LD-carboxypeptidase A, N-terminal domain {Pseudomonas aeruginosa [TaxId: 287]}
sdqtwqpidgrvaliapasaiatevleatlrqlevhgvdyhlgrhvearyrylagtveqr
ledlhnafdmpditavwclrggygcgqllpgldwgrleaasprpligfsdisvllsafhr
hglpaihgpvatglglsplsapreqqerlaslasvsrllagid

Sequence, based on observed residues (ATOM records):

>d1zrsb2 c.23.16.7 (B:7-169) LD-carboxypeptidase A, N-terminal domain {Pseudomonas aeruginosa [TaxId: 287]}
sdqtwqpidgrvaliapasaiatevleatlrqlevhgvdyhlgrhvearyrylagtveqr
ledlhnafdmpditavwclrggygcgqllpgldwgrleaasprpligfsdisvllsafhr
hglpaihgpvatglgleqqerlaslasvsrllagid

Timeline for d1zrsb2:

• d1zrsb2 first appeared in SCOP 1.73
  
• d1zrsb2 appears in SCOPe 2.06
  
• d1zrsb2 appears in the current release, SCOPe 2.08