Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies) 3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology this domain is thought to be mobile in most multi-domain proteins known to contain it |
Superfamily c.8.10: LD-carboxypeptidase A C-terminal domain-like [141986] (1 family) |
Family c.8.10.1: LD-carboxypeptidase A C-terminal domain-like [141987] (1 protein) C-terminal half of Pfam PF02016 |
Protein LD-carboxypeptidase A, C-terminal domain [141988] (1 species) |
Species Pseudomonas aeruginosa [TaxId:287] [141989] (4 PDB entries) Uniprot Q9HTZ1 152-307! Uniprot Q9HTZ1 170-307 |
Domain d1zrsb1: 1zrs B:170-307 [125558] Other proteins in same PDB: d1zrsa2, d1zrsb2 automated match to d1zrsa1 |
PDB Entry: 1zrs (more details), 1.5 Å
SCOPe Domain Sequences for d1zrsb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zrsb1 c.8.10.1 (B:170-307) LD-carboxypeptidase A, C-terminal domain {Pseudomonas aeruginosa [TaxId: 287]} helpvqhlgghkqrvegaliggnltalacmagtlgglhapagsilvledvgepyyrlers lwqllesidarqlgaiclgsftdcprkevahslerifgeyaaaievplyhhlpsghgaqn rawpygktavlegnrlrw
Timeline for d1zrsb1: