SCOPe 2.07: Domain d1zrsb1: 1zrs B:170-307

Lineage for d1zrsb1 (1zrs B:170-307)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
   3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
   this domain is thought to be mobile in most multi-domain proteins known to contain it

4. Superfamily c.8.10: LD-carboxypeptidase A C-terminal domain-like [141986] (1 family)

5. Family c.8.10.1: LD-carboxypeptidase A C-terminal domain-like [141987] (1 protein)
   C-terminal half of Pfam PF02016

6. Protein LD-carboxypeptidase A, C-terminal domain [141988] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [141989] (4 PDB entries)
   Uniprot Q9HTZ1 152-307! Uniprot Q9HTZ1 170-307

8. Domain d1zrsb1: 1zrs B:170-307 [125558]
   Other proteins in same PDB: d1zrsa2, d1zrsb2
   automated match to d1zrsa1

Details for d1zrsb1

PDB Entry: 1zrs, 1.5 Å

PDB Description: wild-type LD-carboxypeptidase

PDB Compounds: (B:) hypothetical protein

SCOPe Domain Sequences for d1zrsb1:

Sequence; same for both SEQRES and ATOM records:

>d1zrsb1 c.8.10.1 (B:170-307) LD-carboxypeptidase A, C-terminal domain {Pseudomonas aeruginosa [TaxId: 287]}
helpvqhlgghkqrvegaliggnltalacmagtlgglhapagsilvledvgepyyrlers
lwqllesidarqlgaiclgsftdcprkevahslerifgeyaaaievplyhhlpsghgaqn
rawpygktavlegnrlrw

Timeline for d1zrsb1:

• d1zrsb1 first appeared in SCOP 1.73
  
• d1zrsb1 appears in SCOPe 2.06
  
• d1zrsb1 appears in the current release, SCOPe 2.08