Lineage for d1zrsb1 (1zrs B:170-307)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 689773Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 690186Superfamily c.8.10: LD-carboxypeptidase A C-terminal domain-like [141986] (1 family) (S)
  5. 690187Family c.8.10.1: LD-carboxypeptidase A C-terminal domain-like [141987] (1 protein)
    C-terminal half of Pfam PF02016
  6. 690188Protein LD-carboxypeptidase A, C-terminal domain [141988] (1 species)
  7. 690189Species Pseudomonas aeruginosa [TaxId:287] [141989] (4 PDB entries)
  8. 690193Domain d1zrsb1: 1zrs B:170-307 [125558]
    Other proteins in same PDB: d1zrsa2, d1zrsb2
    automatically matched to 1ZRS A:170-307

Details for d1zrsb1

PDB Entry: 1zrs (more details), 1.5 Å

PDB Description: wild-type LD-carboxypeptidase
PDB Compounds: (B:) hypothetical protein

SCOP Domain Sequences for d1zrsb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zrsb1 c.8.10.1 (B:170-307) LD-carboxypeptidase A, C-terminal domain {Pseudomonas aeruginosa [TaxId: 287]}
helpvqhlgghkqrvegaliggnltalacmagtlgglhapagsilvledvgepyyrlers
lwqllesidarqlgaiclgsftdcprkevahslerifgeyaaaievplyhhlpsghgaqn
rawpygktavlegnrlrw

SCOP Domain Coordinates for d1zrsb1:

Click to download the PDB-style file with coordinates for d1zrsb1.
(The format of our PDB-style files is described here.)

Timeline for d1zrsb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zrsb2