SCOPe 2.06: Domain d1zrra_: 1zrr A:

Lineage for d1zrra_ (1zrr A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.6: Acireductone dioxygenase [82191] (2 proteins)
   automatically mapped to Pfam PF03079

6. Protein Acireductone dioxygenase [82192] (2 species)

7. Species Klebsiella pneumoniae [TaxId:573] [82193] (1 PDB entry)
   NMR-derived model

8. Domain d1zrra_: 1zrr A: [125555]
   automated match to d1zrra1
   complexed with ni

Details for d1zrra_

PDB Entry: 1zrr

PDB Description: residual dipolar coupling refinement of acireductone dioxygenase from klebsiella

PDB Compounds: (A:) E-2/E-2' protein

SCOPe Domain Sequences for d1zrra_:

Sequence; same for both SEQRES and ATOM records:

>d1zrra_ b.82.1.6 (A:) Acireductone dioxygenase {Klebsiella pneumoniae [TaxId: 573]}
saltifsvkdpqnslwhstnaeeiqqqlnakgvrferwqadrdlgaaptaetviaayqha
idklvaekgyqswdvislradnpqkealrekflnehthgedevrffvegaglfclhigde
vfqvlcekndlisvpahtphwfdmgsepnftairifdnpegwiaqftgddiasayprla

Timeline for d1zrra_:

• d1zrra_ first appeared in SCOP 1.73, called d1zrra1
  
• d1zrra_ appears in SCOPe 2.05
  
• d1zrra_ appears in SCOPe 2.07
  
• d1zrra_ appears in the current release, SCOPe 2.08