![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.1: RmlC-like cupins [51182] (25 families) ![]() |
![]() | Family b.82.1.6: Acireductone dioxygenase [82191] (1 protein) |
![]() | Protein Acireductone dioxygenase [82192] (2 species) |
![]() | Species Klebsiella pneumoniae [TaxId:573] [82193] (1 PDB entry) NMR-derived model |
![]() | Domain d1zrra1: 1zrr A:1-179 [125555] automatically matched to d1m4oa_ complexed with ni |
PDB Entry: 1zrr (more details)
SCOPe Domain Sequences for d1zrra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zrra1 b.82.1.6 (A:1-179) Acireductone dioxygenase {Klebsiella pneumoniae [TaxId: 573]} saltifsvkdpqnslwhstnaeeiqqqlnakgvrferwqadrdlgaaptaetviaayqha idklvaekgyqswdvislradnpqkealrekflnehthgedevrffvegaglfclhigde vfqvlcekndlisvpahtphwfdmgsepnftairifdnpegwiaqftgddiasayprla
Timeline for d1zrra1: