SCOP 1.75: Domain d1zrra1: 1zrr A:1-179

Lineage for d1zrra1 (1zrr A:1-179)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (24 families)

5. Family b.82.1.6: Acireductone dioxygenase [82191] (1 protein)

6. Protein Acireductone dioxygenase [82192] (2 species)

7. Species Klebsiella pneumoniae [TaxId:573] [82193] (1 PDB entry)
   NMR-derived model

8. Domain d1zrra1: 1zrr A:1-179 [125555]
   automatically matched to d1m4oa_
   complexed with ni

Details for d1zrra1

PDB Entry: 1zrr

PDB Description: residual dipolar coupling refinement of acireductone dioxygenase from klebsiella

PDB Compounds: (A:) E-2/E-2' protein

SCOP Domain Sequences for d1zrra1:

Sequence; same for both SEQRES and ATOM records:

>d1zrra1 b.82.1.6 (A:1-179) Acireductone dioxygenase {Klebsiella pneumoniae [TaxId: 573]}
saltifsvkdpqnslwhstnaeeiqqqlnakgvrferwqadrdlgaaptaetviaayqha
idklvaekgyqswdvislradnpqkealrekflnehthgedevrffvegaglfclhigde
vfqvlcekndlisvpahtphwfdmgsepnftairifdnpegwiaqftgddiasayprla

Timeline for d1zrra1:

• d1zrra1 first appeared in SCOP 1.73
  
• d1zrra1 appears in SCOPe 2.01
  
• d1zrra1 appears in the current release, SCOPe 2.08, called d1zrra_