Lineage for d1zrra_ (1zrr A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. Family b.82.1.6: Acireductone dioxygenase [82191] (2 proteins)
    automatically mapped to Pfam PF03079
  6. Protein Acireductone dioxygenase [82192] (2 species)
  7. Species Klebsiella pneumoniae [TaxId:573] [82193] (1 PDB entry)
    NMR-derived model
  8. Domain d1zrra_: 1zrr A: [125555]
    automated match to d1zrra1
    complexed with ni

Details for d1zrra_

PDB Entry: 1zrr (more details)

PDB Description: Residual Dipolar Coupling Refinement of Acireductone Dioxygenase from Klebsiella
PDB Compounds: (A:) E-2/E-2' protein

SCOPe Domain Sequences for d1zrra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zrra_ b.82.1.6 (A:) Acireductone dioxygenase {Klebsiella pneumoniae [TaxId: 573]}
saltifsvkdpqnslwhstnaeeiqqqlnakgvrferwqadrdlgaaptaetviaayqha
idklvaekgyqswdvislradnpqkealrekflnehthgedevrffvegaglfclhigde
vfqvlcekndlisvpahtphwfdmgsepnftairifdnpegwiaqftgddiasayprla

SCOPe Domain Coordinates for d1zrra_ are not available.

Timeline for d1zrra_: