Lineage for d1zrob2 (1zro B:283-601)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2016272Fold a.264: Duffy binding domain-like [140923] (1 superfamily)
    consist of two subdomains, each containing a three-helical bundle
  4. 2016273Superfamily a.264.1: Duffy binding domain-like [140924] (2 families) (S)
    automatically mapped to Pfam PF05424
  5. 2016274Family a.264.1.1: Duffy binding domain [140925] (3 protein domains)
    Pfam PF05424
  6. 2016278Protein Erythrocyte binding antigen region II [140928] (1 species)
    duplication; tandem repeat of two Duffy-binding domain
  7. 2016279Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [140929] (2 PDB entries)
    Uniprot Q25735 283-596! Uniprot Q25735 8-282
  8. 2016283Domain d1zrob2: 1zro B:283-601 [125554]
    automated match to d1zrla2
    complexed with cl, so4

Details for d1zrob2

PDB Entry: 1zro (more details), 2.25 Å

PDB Description: Crystal structure of EBA-175 Region II (RII) crystallized in the presence of (alpha)2,3-sialyllactose
PDB Compounds: (B:) erythrocyte binding antigen region II

SCOPe Domain Sequences for d1zrob2:

Sequence, based on SEQRES records: (download)

>d1zrob2 a.264.1.1 (B:283-601) Erythrocyte binding antigen region II {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
ckhtttlvksvlngndntikekrehidlddfskfgcdknsvdtntkvweckkpyklstkd
vcvpprrqelclgnidriydknllmikehilaiaiyesrilkrkyknkddkevckiinkt
fadirdiiggtdywndlsnrklvgkintnsnyvhrnkqndklfrdewwkvikkdvwnvis
wvfkdktvckeddienipqffrwfsewgddycqdktkmietlkveckekpceddnckrkc
nsykewiskkkeeynkqakqyqeyqkgnnykmysefksikpevylkkysekcsnlnfede
fkeelhsdyknkctmcpev

Sequence, based on observed residues (ATOM records): (download)

>d1zrob2 a.264.1.1 (B:283-601) Erythrocyte binding antigen region II {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
ckhtttlvksvlngndntikekrehidlddfskfgcdknsvdtntkvweckkpyklstkd
vcvpprrqelclgnidriydknllmikehilaiaiyesrilkrkyknkddkevckiinkt
fadirdiiggtdywndlsnrklvgkintnsnyvhrnkqndklfrdewwkvikkdvwnvis
wvfkdktvckeddienipqffrwfsewgddycqdktkmietlkvecceddnckrkcnsyk
ewiskkkeeynkqakqyqeyqkgnnykmysefksikpevylkkysekcsnlnfedefkee
lhsdyknkctmcpev

SCOPe Domain Coordinates for d1zrob2:

Click to download the PDB-style file with coordinates for d1zrob2.
(The format of our PDB-style files is described here.)

Timeline for d1zrob2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zrob1