![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.94: Olfactory marker protein [63696] (1 superfamily) sandwich; 8 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.94.1: Olfactory marker protein [63697] (1 family) ![]() automatically mapped to Pfam PF06554 |
![]() | Family b.94.1.1: Olfactory marker protein [63698] (1 protein) |
![]() | Protein Olfactory marker protein [63699] (2 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [69207] (2 PDB entries) |
![]() | Domain d1zria_: 1zri A: [125547] automated match to d1zria1 |
PDB Entry: 1zri (more details)
SCOPe Domain Sequences for d1zria_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zria_ b.94.1.1 (A:) Olfactory marker protein {Norway rat (Rattus norvegicus) [TaxId: 10116]} maedgpqkqqldmplvldqdltkqmrlrveslkqrgekkqdgekllrpaesvyrldfiqq qklqfdhwnvvldkpgkvtitgtsqnwtpdltnlmtrqlldpaaifwrkedsdamdwnea dalefgerlsdlakirkvmyflitfgegvepanlkasvvfnql
Timeline for d1zria_: