Lineage for d1zrfb2 (1zrf B:8-137)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 809734Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 810399Superfamily b.82.3: cAMP-binding domain-like [51206] (3 families) (S)
  5. 810405Family b.82.3.2: cAMP-binding domain [51210] (12 proteins)
    Pfam PF00027
  6. 810406Protein Catabolite gene activator protein, N-terminal domain [51211] (1 species)
  7. 810407Species Escherichia coli [TaxId:562] [51212] (19 PDB entries)
  8. 810411Domain d1zrfb2: 1zrf B:8-137 [125546]
    Other proteins in same PDB: d1zrfa1, d1zrfb1
    automatically matched to d1i5zb2
    complexed with cmp, dio

Details for d1zrfb2

PDB Entry: 1zrf (more details), 2.1 Å

PDB Description: 4 crystal structures of cap-dna with all base-pair substitutions at position 6, cap-[6c;17g]icap38 dna
PDB Compounds: (B:) Catabolite gene activator

SCOP Domain Sequences for d1zrfb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zrfb2 b.82.3.2 (B:8-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]}
dptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemilsylnqg
dfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqmarrlqvt
sekvgnlafl

SCOP Domain Coordinates for d1zrfb2:

Click to download the PDB-style file with coordinates for d1zrfb2.
(The format of our PDB-style files is described here.)

Timeline for d1zrfb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zrfb1