Lineage for d1zrfb1 (1zrf B:138-207)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693005Family a.4.5.4: CAP C-terminal domain-like [46796] (9 proteins)
  6. 2693006Protein Catabolite gene activator protein (CAP), C-terminal domain [46797] (1 species)
    N-terminal domain has double beta-helix fold
  7. 2693007Species Escherichia coli [TaxId:562] [46798] (28 PDB entries)
  8. 2693030Domain d1zrfb1: 1zrf B:138-207 [125545]
    Other proteins in same PDB: d1zrfa2, d1zrfb2
    automated match to d1i5zb1
    protein/DNA complex; complexed with cmp, dio

Details for d1zrfb1

PDB Entry: 1zrf (more details), 2.1 Å

PDB Description: 4 crystal structures of cap-dna with all base-pair substitutions at position 6, cap-[6c;17g]icap38 dna
PDB Compounds: (B:) Catabolite gene activator

SCOPe Domain Sequences for d1zrfb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zrfb1 a.4.5.4 (B:138-207) Catabolite gene activator protein (CAP), C-terminal domain {Escherichia coli [TaxId: 562]}
dvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgrilkmledqnlis
ahgktivvyg

SCOPe Domain Coordinates for d1zrfb1:

Click to download the PDB-style file with coordinates for d1zrfb1.
(The format of our PDB-style files is described here.)

Timeline for d1zrfb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zrfb2