Lineage for d1zrfa2 (1zrf A:8-137)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1138044Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 1138884Superfamily b.82.3: cAMP-binding domain-like [51206] (3 families) (S)
  5. 1138890Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
    Pfam PF00027
  6. 1138891Protein Catabolite gene activator protein, N-terminal domain [51211] (1 species)
  7. 1138892Species Escherichia coli [TaxId:562] [51212] (19 PDB entries)
  8. 1138897Domain d1zrfa2: 1zrf A:8-137 [125544]
    Other proteins in same PDB: d1zrfa1, d1zrfb1
    automatically matched to d1i5zb2
    protein/DNA complex; complexed with cmp, dio

Details for d1zrfa2

PDB Entry: 1zrf (more details), 2.1 Å

PDB Description: 4 crystal structures of cap-dna with all base-pair substitutions at position 6, cap-[6c;17g]icap38 dna
PDB Compounds: (A:) Catabolite gene activator

SCOPe Domain Sequences for d1zrfa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zrfa2 b.82.3.2 (A:8-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]}
dptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemilsylnqg
dfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqmarrlqvt
sekvgnlafl

SCOPe Domain Coordinates for d1zrfa2:

Click to download the PDB-style file with coordinates for d1zrfa2.
(The format of our PDB-style files is described here.)

Timeline for d1zrfa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zrfa1