SCOP 1.75: Domain d1zrfa1: 1zrf A:138-207

Lineage for d1zrfa1 (1zrf A:138-207)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.4: CAP C-terminal domain-like [46796] (8 proteins)

6. Protein Catabolite gene activator protein (CAP), C-terminal domain [46797] (1 species)
   N-terminal domain has double beta-helix fold

7. Species Escherichia coli [TaxId:562] [46798] (19 PDB entries)

8. Domain d1zrfa1: 1zrf A:138-207 [125543]
   Other proteins in same PDB: d1zrfa2, d1zrfb2
   automatically matched to d1lb2a1
   complexed with cmp, dio

Details for d1zrfa1

PDB Entry: 1zrf, 2.1 Å

PDB Description: 4 crystal structures of cap-dna with all base-pair substitutions at position 6, cap-[6c;17g]icap38 dna

PDB Compounds: (A:) Catabolite gene activator

SCOP Domain Sequences for d1zrfa1:

Sequence; same for both SEQRES and ATOM records:

>d1zrfa1 a.4.5.4 (A:138-207) Catabolite gene activator protein (CAP), C-terminal domain {Escherichia coli [TaxId: 562]}
dvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgrilkmledqnlis
ahgktivvyg

Timeline for d1zrfa1:

• d1zrfa1 first appeared in SCOP 1.73
  
• d1zrfa1 appears in SCOPe 2.01
  
• d1zrfa1 appears in the current release, SCOPe 2.08