SCOP 1.75: Domain d1zreb2: 1zre B:8-137

Lineage for d1zreb2 (1zre B:8-137)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (3 families)

5. Family b.82.3.2: cAMP-binding domain [51210] (12 proteins)
   Pfam PF00027

6. Protein Catabolite gene activator protein, N-terminal domain [51211] (1 species)

7. Species Escherichia coli [TaxId:562] [51212] (19 PDB entries)

8. Domain d1zreb2: 1zre B:8-137 [125542]
   Other proteins in same PDB: d1zrea1, d1zreb1
   automatically matched to d1i5zb2
   complexed with cmp

Details for d1zreb2

PDB Entry: 1zre, 2.8 Å

PDB Description: 4 crystal structures of cap-dna with all base-pair substitutions at position 6, cap-[6g;17c]icap38 dna

PDB Compounds: (B:) Catabolite gene activator

SCOP Domain Sequences for d1zreb2:

Sequence; same for both SEQRES and ATOM records:

>d1zreb2 b.82.3.2 (B:8-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]}
dptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemilsylnqg
dfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqmarrlqvt
sekvgnlafl

Timeline for d1zreb2:

• d1zreb2 first appeared in SCOP 1.73
  
• d1zreb2 appears in SCOPe 2.01
  
• d1zreb2 appears in the current release, SCOPe 2.08