Lineage for d1zrdb2 (1zrd B:8-137)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 677266Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 677861Superfamily b.82.3: cAMP-binding domain-like [51206] (3 families) (S)
  5. 677867Family b.82.3.2: cAMP-binding domain [51210] (10 proteins)
    Pfam PF00027
  6. 677868Protein Catabolite gene activator protein, N-terminal domain [51211] (1 species)
  7. 677869Species Escherichia coli [TaxId:562] [51212] (19 PDB entries)
  8. 677890Domain d1zrdb2: 1zrd B:8-137 [125538]
    Other proteins in same PDB: d1zrda1, d1zrdb1
    automatically matched to d1i5zb2
    complexed with cmp

Details for d1zrdb2

PDB Entry: 1zrd (more details), 2.8 Å

PDB Description: 4 crystal structures of cap-dna with all base-pair substitutions at position 6, cap-[6a;17t]icap38 dna
PDB Compounds: (B:) Catabolite gene activator

SCOP Domain Sequences for d1zrdb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zrdb2 b.82.3.2 (B:8-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]}
dptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemilsylnqg
dfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqmarrlqvt
sekvgnlafl

SCOP Domain Coordinates for d1zrdb2:

Click to download the PDB-style file with coordinates for d1zrdb2.
(The format of our PDB-style files is described here.)

Timeline for d1zrdb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zrdb1