Class g: Small proteins [56992] (85 folds) |
Fold g.37: C2H2 and C2HC zinc fingers [57666] (1 superfamily) alpha+beta metal(zinc)-bound fold: beta-hairpin + alpha-helix |
Superfamily g.37.1: C2H2 and C2HC zinc fingers [57667] (6 families) |
Family g.37.1.1: Classic zinc finger, C2H2 [57668] (30 proteins) |
Protein Zinc finger protein 593, ZNF593 [144151] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [144152] (1 PDB entry) |
Domain d1zr9a1: 1zr9 A:28-94 [125529] complexed with zn |
PDB Entry: 1zr9 (more details)
SCOP Domain Sequences for d1zr9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zr9a1 g.37.1.1 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} dpnaefdpdlpggglhrclacaryfidstnlkthfrskdhkkrlkqlsvepysqeeaera agmgsyv
Timeline for d1zr9a1: