Lineage for d1zr9a1 (1zr9 A:28-94)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 749946Fold g.37: C2H2 and C2HC zinc fingers [57666] (1 superfamily)
    alpha+beta metal(zinc)-bound fold: beta-hairpin + alpha-helix
  4. 749947Superfamily g.37.1: C2H2 and C2HC zinc fingers [57667] (6 families) (S)
  5. 749948Family g.37.1.1: Classic zinc finger, C2H2 [57668] (30 proteins)
  6. 750144Protein Zinc finger protein 593, ZNF593 [144151] (1 species)
  7. 750145Species Human (Homo sapiens) [TaxId:9606] [144152] (1 PDB entry)
  8. 750146Domain d1zr9a1: 1zr9 A:28-94 [125529]
    complexed with zn

Details for d1zr9a1

PDB Entry: 1zr9 (more details)

PDB Description: solution structure of a human c2h2-type zinc finger protein
PDB Compounds: (A:) Zinc finger protein 593

SCOP Domain Sequences for d1zr9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zr9a1 g.37.1.1 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]}
dpnaefdpdlpggglhrclacaryfidstnlkthfrskdhkkrlkqlsvepysqeeaera
agmgsyv

SCOP Domain Coordinates for d1zr9a1:

Click to download the PDB-style file with coordinates for d1zr9a1.
(The format of our PDB-style files is described here.)

Timeline for d1zr9a1: