Lineage for d1zr9a1 (1zr9 A:28-94)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3035157Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
    simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC
  4. 3035158Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) (S)
  5. 3035498Family g.37.1.4: HkH motif-containing C2H2 finger [111436] (4 proteins)
    putative dsRNA-specific zinc finger with a helix-kink-helix (HkH) motif; the kink results from the incompatibility of the cation-coordinating H-x5-H motif with a regular alpha-helix and contributes to RNA recognition
  6. 3035510Protein Zinc finger protein 593, ZNF593 [144151] (1 species)
  7. 3035511Species Human (Homo sapiens) [TaxId:9606] [144152] (1 PDB entry)
    Uniprot O00488 28-94
  8. 3035512Domain d1zr9a1: 1zr9 A:28-94 [125529]
    complexed with zn

Details for d1zr9a1

PDB Entry: 1zr9 (more details)

PDB Description: solution structure of a human c2h2-type zinc finger protein
PDB Compounds: (A:) Zinc finger protein 593

SCOPe Domain Sequences for d1zr9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]}
dpnaefdpdlpggglhrclacaryfidstnlkthfrskdhkkrlkqlsvepysqeeaera
agmgsyv

SCOPe Domain Coordinates for d1zr9a1:

Click to download the PDB-style file with coordinates for d1zr9a1.
(The format of our PDB-style files is described here.)

Timeline for d1zr9a1: