Class g: Small proteins [56992] (100 folds) |
Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily) simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC |
Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) |
Family g.37.1.4: HkH motif-containing C2H2 finger [111436] (4 proteins) putative dsRNA-specific zinc finger with a helix-kink-helix (HkH) motif; the kink results from the incompatibility of the cation-coordinating H-x5-H motif with a regular alpha-helix and contributes to RNA recognition |
Protein Zinc finger protein 593, ZNF593 [144151] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [144152] (1 PDB entry) Uniprot O00488 28-94 |
Domain d1zr9a1: 1zr9 A:28-94 [125529] complexed with zn |
PDB Entry: 1zr9 (more details)
SCOPe Domain Sequences for d1zr9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} dpnaefdpdlpggglhrclacaryfidstnlkthfrskdhkkrlkqlsvepysqeeaera agmgsyv
Timeline for d1zr9a1: