SCOPe 2.06: Domain d1zr5b_: 1zr5 B:

Lineage for d1zr5b_ (1zr5 B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.50: Macro domain-like [52948] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest

4. Superfamily c.50.1: Macro domain-like [52949] (4 families)

5. Family c.50.1.2: Macro domain [89724] (7 proteins)
   found in different proteins, including macro-H2a histone and the Appr-1"-p processing enzyme

6. Protein Histone macro-H2a1.1 [142547] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [142549] (6 PDB entries)
   Uniprot O75367 179-367! Uniprot O75367 181-371

8. Domain d1zr5b_: 1zr5 B: [125526]
   automated match to d1zr5a1

Details for d1zr5b_

PDB Entry: 1zr5, 2.92 Å

PDB Description: Crystal structure of the macro-domain of human core histone variant macroH2A1.2

PDB Compounds: (B:) H2AFY protein

SCOPe Domain Sequences for d1zr5b_:

Sequence; same for both SEQRES and ATOM records:

>d1zr5b_ c.50.1.2 (B:) Histone macro-H2a1.1 {Human (Homo sapiens) [TaxId: 9606]}
ftvlstkslflgqklnlihseisnlagfeveaiinptnadidlkddlgntlekkggkefv
eavlelrkkngplevagaavsaghglpakfvihcnspvwgadkceellektvknclalad
dkklksiafpsigsgrngfpkqtaaqlilkaissyfvstmsssiktvyfvlfdsesigiy
vqemakl

Timeline for d1zr5b_:

• d1zr5b_ first appeared in SCOP 1.73, called d1zr5b1
  
• d1zr5b_ appears in SCOPe 2.05
  
• d1zr5b_ appears in SCOPe 2.07
  
• d1zr5b_ appears in the current release, SCOPe 2.08