![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (21 families) ![]() consists only of helices |
![]() | Family a.4.1.2: Recombinase DNA-binding domain [46728] (5 proteins) |
![]() | Protein gamma,delta resolvase (C-terminal domain) [46731] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [46732] (6 PDB entries) |
![]() | Domain d1zr4e1: 1zr4 E:141-183 [125523] Other proteins in same PDB: d1zr4a2, d1zr4b2, d1zr4d2, d1zr4e2 automatically matched to d1gdta1 protein/DNA complex |
PDB Entry: 1zr4 (more details), 3.4 Å
SCOPe Domain Sequences for d1zr4e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zr4e1 a.4.1.2 (E:141-183) gamma,delta resolvase (C-terminal domain) {Escherichia coli [TaxId: 562]} grkrkidrdavlnmwqqglgashisktmniarstvykvinesn
Timeline for d1zr4e1: