Lineage for d1zr4d1 (1zr4 D:141-183)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305223Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 2305444Family a.4.1.2: Recombinase DNA-binding domain [46728] (5 proteins)
  6. 2305445Protein gamma,delta resolvase (C-terminal domain) [46731] (1 species)
  7. 2305446Species Escherichia coli [TaxId:562] [46732] (6 PDB entries)
  8. 2305451Domain d1zr4d1: 1zr4 D:141-183 [125521]
    Other proteins in same PDB: d1zr4a2, d1zr4b2, d1zr4d2, d1zr4e2
    automatically matched to d1gdta1
    protein/DNA complex

Details for d1zr4d1

PDB Entry: 1zr4 (more details), 3.4 Å

PDB Description: structure of a synaptic gamma-delta resolvase tetramer covalently linked to two cleaved dnas
PDB Compounds: (D:) transposon gamma-delta resolvase

SCOPe Domain Sequences for d1zr4d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zr4d1 a.4.1.2 (D:141-183) gamma,delta resolvase (C-terminal domain) {Escherichia coli [TaxId: 562]}
grkrkidrdavlnmwqqglgashisktmniarstvykvinesn

SCOPe Domain Coordinates for d1zr4d1:

Click to download the PDB-style file with coordinates for d1zr4d1.
(The format of our PDB-style files is described here.)

Timeline for d1zr4d1: