Lineage for d1zr4b1 (1zr4 B:141-183)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2691999Family a.4.1.2: Recombinase DNA-binding domain [46728] (5 proteins)
  6. 2692000Protein gamma,delta resolvase (C-terminal domain) [46731] (1 species)
  7. 2692001Species Escherichia coli [TaxId:562] [46732] (6 PDB entries)
  8. 2692005Domain d1zr4b1: 1zr4 B:141-183 [125519]
    Other proteins in same PDB: d1zr4a2, d1zr4b2, d1zr4d2, d1zr4e2
    automatically matched to d1gdta1
    protein/DNA complex

Details for d1zr4b1

PDB Entry: 1zr4 (more details), 3.4 Å

PDB Description: structure of a synaptic gamma-delta resolvase tetramer covalently linked to two cleaved dnas
PDB Compounds: (B:) transposon gamma-delta resolvase

SCOPe Domain Sequences for d1zr4b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zr4b1 a.4.1.2 (B:141-183) gamma,delta resolvase (C-terminal domain) {Escherichia coli [TaxId: 562]}
grkrkidrdavlnmwqqglgashisktmniarstvykvinesn

SCOPe Domain Coordinates for d1zr4b1:

Click to download the PDB-style file with coordinates for d1zr4b1.
(The format of our PDB-style files is described here.)

Timeline for d1zr4b1: