SCOP 1.73: Domain d1zr3d1: 1zr3 D:183-366

Lineage for d1zr3d1 (1zr3 D:183-366)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.50: Macro domain-like [52948] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest

4. Superfamily c.50.1: Macro domain-like [52949] (2 families)

5. Family c.50.1.2: Macro domain [89724] (6 proteins)
   found in different proteins, including macro-H2a histone and the Appr-1"-p processing enzyme

6. Protein Histone macro-H2a1.1 [142547] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [142549] (3 PDB entries)

8. Domain d1zr3d1: 1zr3 D:183-366 [125516]
   automatically matched to 2FXK A:182-368
   complexed with mes

Details for d1zr3d1

PDB Entry: 1zr3, 1.66 Å

PDB Description: Crystal structure of the macro-domain of human core histone variant macroH2A1.1 (form B)

PDB Compounds: (D:) histone macroH2A1.1

SCOP Domain Sequences for d1zr3d1:

Sequence; same for both SEQRES and ATOM records:

>d1zr3d1 c.50.1.2 (D:183-366) Histone macro-H2a1.1 {Human (Homo sapiens) [TaxId: 9606]}
ftvlstkslflgqklqvvqadiasidsdavvhptntdfyiggevgntlekkggkefveav
lelrkkngplevagaavsaghglpakfvihcnspvwgadkceellektvknclaladdkk
lksiafpsigsgrngfpkqtaaqlilkaissyfvstmsssiktvyfvlfdsesigiyvqe
makl

Timeline for d1zr3d1:

• d1zr3d1 is new in SCOP 1.73
  
• d1zr3d1 appears in SCOP 1.75
  
• d1zr3d1 appears in the current release, SCOPe 2.08, called d1zr3d_