Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.50: Macro domain-like [52948] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest |
Superfamily c.50.1: Macro domain-like [52949] (2 families) |
Family c.50.1.2: Macro domain [89724] (6 proteins) found in different proteins, including macro-H2a histone and the Appr-1"-p processing enzyme |
Protein Histone macro-H2a1.1 [142547] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [142549] (3 PDB entries) |
Domain d1zr3d1: 1zr3 D:183-366 [125516] automatically matched to 2FXK A:182-368 complexed with mes |
PDB Entry: 1zr3 (more details), 1.66 Å
SCOP Domain Sequences for d1zr3d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zr3d1 c.50.1.2 (D:183-366) Histone macro-H2a1.1 {Human (Homo sapiens) [TaxId: 9606]} ftvlstkslflgqklqvvqadiasidsdavvhptntdfyiggevgntlekkggkefveav lelrkkngplevagaavsaghglpakfvihcnspvwgadkceellektvknclaladdkk lksiafpsigsgrngfpkqtaaqlilkaissyfvstmsssiktvyfvlfdsesigiyvqe makl
Timeline for d1zr3d1: