SCOPe 2.08: Domain d1zr2b1: 1zr2 B:141-183

Lineage for d1zr2b1 (1zr2 B:141-183)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (21 families)
   consists only of helices

5. Family a.4.1.2: Recombinase DNA-binding domain [46728] (5 proteins)

6. Protein gamma,delta resolvase (C-terminal domain) [46731] (1 species)

7. Species Escherichia coli [TaxId:562] [46732] (6 PDB entries)

8. Domain d1zr2b1: 1zr2 B:141-183 [125511]
   Other proteins in same PDB: d1zr2a2, d1zr2b2
   automatically matched to d1gdta1
   protein/DNA complex

Details for d1zr2b1

PDB Entry: 1zr2, 3.9 Å

PDB Description: structure of a synaptic gamma-delta resolvase tetramer covalently linked to two cleaved dnas

PDB Compounds: (B:) transposon gamma-delta resolvase

SCOPe Domain Sequences for d1zr2b1:

Sequence; same for both SEQRES and ATOM records:

>d1zr2b1 a.4.1.2 (B:141-183) gamma,delta resolvase (C-terminal domain) {Escherichia coli [TaxId: 562]}
grkrkidrdavlnmwqqglgashisktmniarstvykvinesn

Timeline for d1zr2b1:

• d1zr2b1 first appeared in SCOP 1.73
  
• d1zr2b1 appears in SCOPe 2.07