Class b: All beta proteins [48724] (165 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins) |
Protein Trypsin(ogen) [50515] (9 species) |
Species Cow (Bos taurus) [TaxId:9913] [50516] (271 PDB entries) |
Domain d1zr0a1: 1zr0 A:16-245 [125507] automatically matched to d1tawa_ complexed with ca |
PDB Entry: 1zr0 (more details), 1.8 Å
SCOP Domain Sequences for d1zr0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zr0a1 b.47.1.2 (A:16-245) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg wgntkssgtsypdvlkclkapilstsscksaypgqitsnmfcagyleggkdscqgdsggp vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
Timeline for d1zr0a1: