SCOPe 2.08: Domain d1zq9b_: 1zq9 B:

Lineage for d1zq9b_ (1zq9 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families)

5. Family c.66.1.24: rRNA adenine dimethylase-like [88784] (5 proteins)

6. Protein automated matches [190861] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188200] (2 PDB entries)

8. Domain d1zq9b_: 1zq9 B: [125506]
   Other proteins in same PDB: d1zq9a1
   automated match to d1zq9a1
   complexed with sam

Details for d1zq9b_

PDB Entry: 1zq9, 1.9 Å

PDB Description: Crystal structure of human Dimethyladenosine transferase

PDB Compounds: (B:) Probable dimethyladenosine transferase

SCOPe Domain Sequences for d1zq9b_:

Sequence; same for both SEQRES and ATOM records:

>d1zq9b_ c.66.1.24 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qhilknpliinsiidkaalrptdvvlevgpgtgnmtvkllekakkvvaceldprlvaelh
krvqgtpvasklqvlvgdvlktdlpffdtcvanlpyqisspfvfklllhrpffrcailmf
qrefalrlvakpgdklycrlsintqllarvdhlmkvgknnfrpppkvessvvriepknpp
ppinfqewdglvritfvrknktlsaafkssavqqlleknyrihcsvhniiipedfsiadk
iqqiltstgfsdkrarsmdiddfirllhgfnaegihfs

Timeline for d1zq9b_:

• d1zq9b_ first appeared in SCOP 1.73, called d1zq9b1
  
• d1zq9b_ appears in SCOPe 2.07