Lineage for d1zq9b_ (1zq9 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2893551Family c.66.1.24: rRNA adenine dimethylase-like [88784] (5 proteins)
  6. 2893574Protein automated matches [190861] (2 species)
    not a true protein
  7. 2893578Species Human (Homo sapiens) [TaxId:9606] [188200] (2 PDB entries)
  8. 2893579Domain d1zq9b_: 1zq9 B: [125506]
    Other proteins in same PDB: d1zq9a1
    automated match to d1zq9a1
    complexed with sam

Details for d1zq9b_

PDB Entry: 1zq9 (more details), 1.9 Å

PDB Description: Crystal structure of human Dimethyladenosine transferase
PDB Compounds: (B:) Probable dimethyladenosine transferase

SCOPe Domain Sequences for d1zq9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zq9b_ c.66.1.24 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qhilknpliinsiidkaalrptdvvlevgpgtgnmtvkllekakkvvaceldprlvaelh
krvqgtpvasklqvlvgdvlktdlpffdtcvanlpyqisspfvfklllhrpffrcailmf
qrefalrlvakpgdklycrlsintqllarvdhlmkvgknnfrpppkvessvvriepknpp
ppinfqewdglvritfvrknktlsaafkssavqqlleknyrihcsvhniiipedfsiadk
iqqiltstgfsdkrarsmdiddfirllhgfnaegihfs

SCOPe Domain Coordinates for d1zq9b_:

Click to download the PDB-style file with coordinates for d1zq9b_.
(The format of our PDB-style files is described here.)

Timeline for d1zq9b_: