Lineage for d1zq9a1 (1zq9 A:36-313)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2893551Family c.66.1.24: rRNA adenine dimethylase-like [88784] (5 proteins)
  6. 2893558Protein Probable dimethyladenosine transferase [142575] (1 species)
  7. 2893559Species Human (Homo sapiens) [TaxId:9606] [142576] (1 PDB entry)
    Uniprot Q9UNQ2 36-313
  8. 2893560Domain d1zq9a1: 1zq9 A:36-313 [125505]
    Other proteins in same PDB: d1zq9b_
    complexed with sam

Details for d1zq9a1

PDB Entry: 1zq9 (more details), 1.9 Å

PDB Description: Crystal structure of human Dimethyladenosine transferase
PDB Compounds: (A:) Probable dimethyladenosine transferase

SCOPe Domain Sequences for d1zq9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zq9a1 c.66.1.24 (A:36-313) Probable dimethyladenosine transferase {Human (Homo sapiens) [TaxId: 9606]}
qhilknpliinsiidkaalrptdvvlevgpgtgnmtvkllekakkvvaceldprlvaelh
krvqgtpvasklqvlvgdvlktdlpffdtcvanlpyqisspfvfklllhrpffrcailmf
qrefalrlvakpgdklycrlsintqllarvdhlmkvgknnfrpppkvessvvriepknpp
ppinfqewdglvritfvrknktlsaafkssavqqlleknyrihcsvhniiipedfsiadk
iqqiltstgfsdkrarsmdiddfirllhgfnaegihfs

SCOPe Domain Coordinates for d1zq9a1:

Click to download the PDB-style file with coordinates for d1zq9a1.
(The format of our PDB-style files is described here.)

Timeline for d1zq9a1: