Lineage for d1zq7d2 (1zq7 D:1-201)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3010585Fold d.309: AMMECR1-like [143446] (1 superfamily)
    duplication; contains two beta(2)-alpha-beta(2) structural repeats, swapped with C-terminal strands; extra N-terminal helix and C-terminal strand
  4. 3010586Superfamily d.309.1: AMMECR1-like [143447] (1 family) (S)
    automatically mapped to Pfam PF01871
  5. 3010587Family d.309.1.1: AMMECR1-like [143448] (4 proteins)
    Pfam PF01871
  6. 3010597Protein automated matches [190816] (2 species)
    not a true protein
  7. 3010598Species Methanosarcina mazei [TaxId:2209] [188201] (1 PDB entry)
  8. 3010601Domain d1zq7d2: 1zq7 D:1-201 [125504]
    Other proteins in same PDB: d1zq7a1, d1zq7a2, d1zq7b3, d1zq7c3, d1zq7d3
    automated match to d1zq7a1

Details for d1zq7d2

PDB Entry: 1zq7 (more details), 2.11 Å

PDB Description: X-Ray Crystal Structure of Protein Q8PZK8 from Methanosarcina mazei. Northeast Structural Genomics Consortium Target MaR9.
PDB Compounds: (D:) Hypothetical protein MM0484

SCOPe Domain Sequences for d1zq7d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zq7d2 d.309.1.1 (D:1-201) automated matches {Methanosarcina mazei [TaxId: 2209]}
mltetegraavklarktieiflskgksprpdasgvelspvfeeyrgvfvtlteggllrgc
ighpypdstlkeaildsaisaatrdprfptveqdemknilvevtiltqpekinaspkelp
dkveigkhglivkqgycqglllpqvapendmdsidflshtcmkaglspdawvkgaevycf
egqifkekepdgevieekfle

SCOPe Domain Coordinates for d1zq7d2:

Click to download the PDB-style file with coordinates for d1zq7d2.
(The format of our PDB-style files is described here.)

Timeline for d1zq7d2: