SCOPe 2.08: Domain d1zq7c2: 1zq7 C:1-201

Lineage for d1zq7c2 (1zq7 C:1-201)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.309: AMMECR1-like [143446] (1 superfamily)
   duplication; contains two beta(2)-alpha-beta(2) structural repeats, swapped with C-terminal strands; extra N-terminal helix and C-terminal strand

4. Superfamily d.309.1: AMMECR1-like [143447] (1 family)
   automatically mapped to Pfam PF01871

5. Family d.309.1.1: AMMECR1-like [143448] (4 proteins)
   Pfam PF01871

6. Protein automated matches [190816] (2 species)
   not a true protein

7. Species Methanosarcina mazei [TaxId:2209] [188201] (1 PDB entry)

8. Domain d1zq7c2: 1zq7 C:1-201 [125503]
   Other proteins in same PDB: d1zq7a1, d1zq7a2, d1zq7b3, d1zq7c3, d1zq7d3
   automated match to d1zq7a1

Details for d1zq7c2

PDB Entry: 1zq7, 2.11 Å

PDB Description: X-Ray Crystal Structure of Protein Q8PZK8 from Methanosarcina mazei. Northeast Structural Genomics Consortium Target MaR9.

PDB Compounds: (C:) Hypothetical protein MM0484

SCOPe Domain Sequences for d1zq7c2:

Sequence; same for both SEQRES and ATOM records:

>d1zq7c2 d.309.1.1 (C:1-201) automated matches {Methanosarcina mazei [TaxId: 2209]}
mltetegraavklarktieiflskgksprpdasgvelspvfeeyrgvfvtlteggllrgc
ighpypdstlkeaildsaisaatrdprfptveqdemknilvevtiltqpekinaspkelp
dkveigkhglivkqgycqglllpqvapendmdsidflshtcmkaglspdawvkgaevycf
egqifkekepdgevieekfle

Timeline for d1zq7c2:

• d1zq7c2 first appeared in SCOP 1.73, called d1zq7c1
  
• d1zq7c2 appears in SCOPe 2.07