Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.309: AMMECR1-like [143446] (1 superfamily) duplication; contains two beta(2)-alpha-beta(2) structural repeats, swapped with C-terminal strands; extra N-terminal helix and C-terminal strand |
Superfamily d.309.1: AMMECR1-like [143447] (1 family) automatically mapped to Pfam PF01871 |
Family d.309.1.1: AMMECR1-like [143448] (4 proteins) Pfam PF01871 |
Protein automated matches [190816] (2 species) not a true protein |
Species Methanosarcina mazei [TaxId:2209] [188201] (1 PDB entry) |
Domain d1zq7c2: 1zq7 C:1-201 [125503] Other proteins in same PDB: d1zq7a1, d1zq7a2, d1zq7b3, d1zq7c3, d1zq7d3 automated match to d1zq7a1 |
PDB Entry: 1zq7 (more details), 2.11 Å
SCOPe Domain Sequences for d1zq7c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zq7c2 d.309.1.1 (C:1-201) automated matches {Methanosarcina mazei [TaxId: 2209]} mltetegraavklarktieiflskgksprpdasgvelspvfeeyrgvfvtlteggllrgc ighpypdstlkeaildsaisaatrdprfptveqdemknilvevtiltqpekinaspkelp dkveigkhglivkqgycqglllpqvapendmdsidflshtcmkaglspdawvkgaevycf egqifkekepdgevieekfle
Timeline for d1zq7c2: