SCOPe 2.08: Domain d1zq7a1: 1zq7 A:1-199

Lineage for d1zq7a1 (1zq7 A:1-199)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.309: AMMECR1-like [143446] (1 superfamily)
   duplication; contains two beta(2)-alpha-beta(2) structural repeats, swapped with C-terminal strands; extra N-terminal helix and C-terminal strand

4. Superfamily d.309.1: AMMECR1-like [143447] (1 family)
   automatically mapped to Pfam PF01871

5. Family d.309.1.1: AMMECR1-like [143448] (4 proteins)
   Pfam PF01871

6. Protein Hypothetical protein MM0484 [143449] (1 species)

7. Species Methanosarcina mazei [TaxId:2209] [143450] (1 PDB entry)
   Uniprot Q8PZK8 1-199

8. Domain d1zq7a1: 1zq7 A:1-199 [125501]
   Other proteins in same PDB: d1zq7a2, d1zq7b2, d1zq7b3, d1zq7c2, d1zq7c3, d1zq7d2, d1zq7d3

Details for d1zq7a1

PDB Entry: 1zq7, 2.11 Å

PDB Description: X-Ray Crystal Structure of Protein Q8PZK8 from Methanosarcina mazei. Northeast Structural Genomics Consortium Target MaR9.

PDB Compounds: (A:) Hypothetical protein MM0484

SCOPe Domain Sequences for d1zq7a1:

Sequence, based on SEQRES records:

>d1zq7a1 d.309.1.1 (A:1-199) Hypothetical protein MM0484 {Methanosarcina mazei [TaxId: 2209]}
mltetegraavklarktieiflskgksprpdasgvelspvfeeyrgvfvtlteggllrgc
ighpypdstlkeaildsaisaatrdprfptveqdemknilvevtiltqpekinaspkelp
dkveigkhglivkqgycqglllpqvapendmdsidflshtcmkaglspdawvkgaevycf
egqifkekepdgevieekf

Sequence, based on observed residues (ATOM records):

>d1zq7a1 d.309.1.1 (A:1-199) Hypothetical protein MM0484 {Methanosarcina mazei [TaxId: 2209]}
mltetegraavklarktieiflskgksprsgvelspvfeeyrgvfvtlteggllrgcigh
pypdstlkeaildsaisaatrdprfptveqdemknilvevtiltqpekinaspkelpdkv
eigkhglivkqgycqglllpqvapendmdsidflshtcmkaglspdawvkgaevycfegq
ifkekepdgevieekf

Timeline for d1zq7a1:

• d1zq7a1 first appeared in SCOP 1.73
  
• d1zq7a1 appears in SCOPe 2.07