Lineage for d1zq3p1 (1zq3 P:2-68)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 634286Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 634287Superfamily a.4.1: Homeodomain-like [46689] (17 families) (S)
    consists only of helices
  5. 634288Family a.4.1.1: Homeodomain [46690] (39 proteins)
    Pfam PF00046
  6. 634370Protein Homeotic bicoid protein [140155] (1 species)
  7. 634371Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [140156] (1 PDB entry)
  8. 634372Domain d1zq3p1: 1zq3 P:2-68 [125499]

Details for d1zq3p1

PDB Entry: 1zq3 (more details)

PDB Description: nmr solution structure of the bicoid homeodomain bound to the consensus dna binding site taatcc
PDB Compounds: (P:) Homeotic bicoid protein

SCOP Domain Sequences for d1zq3p1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
prrtrttftssqiaeleqhflqgryltaprladlsaklalgtaqvkiwfknrrrrhkiqs
dqhkdqs

SCOP Domain Coordinates for d1zq3p1:

Click to download the PDB-style file with coordinates for d1zq3p1.
(The format of our PDB-style files is described here.)

Timeline for d1zq3p1: