Lineage for d1zq3p1 (1zq3 P:2-68)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1981148Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1981149Family a.4.1.1: Homeodomain [46690] (41 protein domains)
    Pfam PF00046
  6. 1981235Protein Homeotic bicoid protein [140155] (1 species)
  7. 1981236Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [140156] (1 PDB entry)
    Uniprot P09081 97-163
  8. 1981237Domain d1zq3p1: 1zq3 P:2-68 [125499]
    Other proteins in same PDB: d1zq3p2
    protein/DNA complex

Details for d1zq3p1

PDB Entry: 1zq3 (more details)

PDB Description: NMR Solution Structure of the Bicoid Homeodomain Bound to the Consensus DNA Binding Site TAATCC
PDB Compounds: (P:) Homeotic bicoid protein

SCOPe Domain Sequences for d1zq3p1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
prrtrttftssqiaeleqhflqgryltaprladlsaklalgtaqvkiwfknrrrrhkiqs
dqhkdqs

SCOPe Domain Coordinates for d1zq3p1:

Click to download the PDB-style file with coordinates for d1zq3p1.
(The format of our PDB-style files is described here.)

Timeline for d1zq3p1: