Lineage for d1zq1b2 (1zq1 B:76-438)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 710029Fold c.88: Glutaminase/Asparaginase [53773] (1 superfamily)
    consists of two non-similar alpha/beta domains, 3 layers (a/b/a) each
    Domain 1 has mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest; left-handed crossover connection between strands 4 and 5
    Domain 2 has parallel beta-sheet of 4 strands, order 1234
  4. 710030Superfamily c.88.1: Glutaminase/Asparaginase [53774] (1 family) (S)
  5. 710031Family c.88.1.1: Glutaminase/Asparaginase [53775] (3 proteins)
  6. 710102Protein Glutamyl-tRNA(Gln) amidotransferase subunit D, GatD [142776] (2 species)
  7. 710106Species Pyrococcus abyssi [TaxId:29292] [142777] (1 PDB entry)
  8. 710108Domain d1zq1b2: 1zq1 B:76-438 [125492]
    Other proteins in same PDB: d1zq1a1, d1zq1b1, d1zq1c1, d1zq1c2, d1zq1c3, d1zq1d1, d1zq1d2, d1zq1d3
    automatically matched to 1ZQ1 A:76-438
    complexed with asp

Details for d1zq1b2

PDB Entry: 1zq1 (more details), 3 Å

PDB Description: Structure of GatDE tRNA-Dependent Amidotransferase from Pyrococcus abyssi
PDB Compounds: (B:) Glutamyl-tRNA(Gln) amidotransferase subunit D

SCOP Domain Sequences for d1zq1b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zq1b2 c.88.1.1 (B:76-438) Glutamyl-tRNA(Gln) amidotransferase subunit D, GatD {Pyrococcus abyssi [TaxId: 29292]}
kpevhfealiegkpglpevtiigtggtiasridyetgavypaftaeelakalpeifevan
vkpkllfnifsedmkpkhwvkiahevakalnsgdygvvvahgtdtmgytaaalsfmlrnl
gkpvvlvgaqrssdrpssdaamnlicsvrmatsevaevmvvmhgetgdtyclahrgtkvr
kmhtsrrdafrsindvpiakiwpngeieflrkdyrkrsdeevevddkieekvalvkvypg
isseiidflvdkgykgiviegtglghtpndiipsieraveegvavcmtsqciygrvnlnv
ystgrkllkagvipcedmlpetayvklmwvlghtqnleevrkmmltnyageitpytrfdt
ylr

SCOP Domain Coordinates for d1zq1b2:

Click to download the PDB-style file with coordinates for d1zq1b2.
(The format of our PDB-style files is described here.)

Timeline for d1zq1b2: