SCOP 1.75: Domain d1zq1a2: 1zq1 A:76-438

Lineage for d1zq1a2 (1zq1 A:76-438)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.88: Glutaminase/Asparaginase [53773] (1 superfamily)
   consists of two non-similar alpha/beta domains, 3 layers (a/b/a) each
   Domain 1 has mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest; left-handed crossover connection between strands 4 and 5
   Domain 2 has parallel beta-sheet of 4 strands, order 1234

4. Superfamily c.88.1: Glutaminase/Asparaginase [53774] (1 family)

5. Family c.88.1.1: Glutaminase/Asparaginase [53775] (3 proteins)

6. Protein Glutamyl-tRNA(Gln) amidotransferase subunit D, GatD [142776] (2 species)

7. Species Pyrococcus abyssi [TaxId:29292] [142777] (1 PDB entry)
   Uniprot Q9V0T9 76-438

8. Domain d1zq1a2: 1zq1 A:76-438 [125490]
   Other proteins in same PDB: d1zq1a1, d1zq1b1, d1zq1c1, d1zq1c2, d1zq1c3, d1zq1d1, d1zq1d2, d1zq1d3
   complexed with asp

Details for d1zq1a2

PDB Entry: 1zq1, 3 Å

PDB Description: Structure of GatDE tRNA-Dependent Amidotransferase from Pyrococcus abyssi

PDB Compounds: (A:) Glutamyl-tRNA(Gln) amidotransferase subunit D

SCOP Domain Sequences for d1zq1a2:

Sequence; same for both SEQRES and ATOM records:

>d1zq1a2 c.88.1.1 (A:76-438) Glutamyl-tRNA(Gln) amidotransferase subunit D, GatD {Pyrococcus abyssi [TaxId: 29292]}
kpevhfealiegkpglpevtiigtggtiasridyetgavypaftaeelakalpeifevan
vkpkllfnifsedmkpkhwvkiahevakalnsgdygvvvahgtdtmgytaaalsfmlrnl
gkpvvlvgaqrssdrpssdaamnlicsvrmatsevaevmvvmhgetgdtyclahrgtkvr
kmhtsrrdafrsindvpiakiwpngeieflrkdyrkrsdeevevddkieekvalvkvypg
isseiidflvdkgykgiviegtglghtpndiipsieraveegvavcmtsqciygrvnlnv
ystgrkllkagvipcedmlpetayvklmwvlghtqnleevrkmmltnyageitpytrfdt
ylr

Timeline for d1zq1a2:

• d1zq1a2 first appeared in SCOP 1.73
  
• d1zq1a2 appears in SCOPe 2.01
  
• d1zq1a2 appears in the current release, SCOPe 2.08