Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.58: CRISPR associated protein Cas2-like [143430] (2 families) contains extra C-terminal beta-strand that integrates into the beta-sheet of the other subunit in the homodimer, a probable biological unit of this superfamily |
Family d.58.58.1: CRISPR associated protein Cas2-like [143431] (5 proteins) Pfam PF09827 |
Protein Hypothetical protein TTP0101 (TT1823) [143432] (1 species) |
Species Thermus thermophilus [TaxId:274] [143433] (1 PDB entry) Uniprot Q746F4 2-83 |
Domain d1zpwx1: 1zpw X:2-83 [125478] |
PDB Entry: 1zpw (more details), 1.64 Å
SCOPe Domain Sequences for d1zpwx1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zpwx1 d.58.58.1 (X:2-83) Hypothetical protein TTP0101 (TT1823) {Thermus thermophilus [TaxId: 274]} gkrlyavaydipddtrrvklanllksygervqlsvfecylderlledlrrrarrlldlgq dalriypvagqvevlgvgplpe
Timeline for d1zpwx1: