Lineage for d1zpwx1 (1zpw X:2-83)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2516578Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2522877Superfamily d.58.58: CRISPR associated protein Cas2-like [143430] (2 families) (S)
    contains extra C-terminal beta-strand that integrates into the beta-sheet of the other subunit in the homodimer, a probable biological unit of this superfamily
  5. 2522878Family d.58.58.1: CRISPR associated protein Cas2-like [143431] (5 proteins)
    Pfam PF09827
  6. 2522895Protein Hypothetical protein TTP0101 (TT1823) [143432] (1 species)
  7. 2522896Species Thermus thermophilus [TaxId:274] [143433] (1 PDB entry)
    Uniprot Q746F4 2-83
  8. 2522897Domain d1zpwx1: 1zpw X:2-83 [125478]

Details for d1zpwx1

PDB Entry: 1zpw (more details), 1.64 Å

PDB Description: Crystal structure of a hypothetical protein TT1823 from Thermus thermophilus
PDB Compounds: (X:) hypothetical protein TT1823

SCOPe Domain Sequences for d1zpwx1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zpwx1 d.58.58.1 (X:2-83) Hypothetical protein TTP0101 (TT1823) {Thermus thermophilus [TaxId: 274]}
gkrlyavaydipddtrrvklanllksygervqlsvfecylderlledlrrrarrlldlgq
dalriypvagqvevlgvgplpe

SCOPe Domain Coordinates for d1zpwx1:

Click to download the PDB-style file with coordinates for d1zpwx1.
(The format of our PDB-style files is described here.)

Timeline for d1zpwx1: