SCOP 1.73: Domain d1zpvb1: 1zpv B:1-83

Lineage for d1zpvb1 (1zpv B:1-83)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.18: ACT-like [55021] (12 families)
   regulatory domain linked to a wide range of metabolic enzymes

5. Family d.58.18.7: SP0238-like [143381] (1 protein)
   stand-alone protein; dimer, the dimerization interface is formed by parallel packing of the subunit beta-sheets

6. Protein UPF0237 protein SP0238 [143382] (1 species)

7. Species Streptococcus pneumoniae [TaxId:1313] [143383] (1 PDB entry)

8. Domain d1zpvb1: 1zpv B:1-83 [125476]
   automatically matched to 1ZPV A:1-83
   complexed with k

Details for d1zpvb1

PDB Entry: 1zpv, 1.9 Å

PDB Description: ACT domain protein from Streptococcus pneumoniae

PDB Compounds: (B:) ACT domain protein

SCOP Domain Sequences for d1zpvb1:

Sequence; same for both SEQRES and ATOM records:

>d1zpvb1 d.58.18.7 (B:1-83) UPF0237 protein SP0238 {Streptococcus pneumoniae [TaxId: 1313]}
mkaiitvvgkdksgivagvsgkiaelglniddisqtvldeyftmmavvssdekqdftylr
nefeafgqtlnvkiniqsaaife

Timeline for d1zpvb1:

• d1zpvb1 is new in SCOP 1.73
  
• d1zpvb1 appears in SCOP 1.75
  
• d1zpvb1 appears in the current release, SCOPe 2.08, called d1zpvb2