![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (55 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.18: ACT-like [55021] (12 families) ![]() regulatory domain linked to a wide range of metabolic enzymes |
![]() | Family d.58.18.7: SP0238-like [143381] (1 protein) stand-alone protein; dimer, the dimerization interface is formed by parallel packing of the subunit beta-sheets |
![]() | Protein UPF0237 protein SP0238 [143382] (1 species) |
![]() | Species Streptococcus pneumoniae [TaxId:1313] [143383] (1 PDB entry) |
![]() | Domain d1zpva1: 1zpv A:1-83 [125475] complexed with k |
PDB Entry: 1zpv (more details), 1.9 Å
SCOP Domain Sequences for d1zpva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zpva1 d.58.18.7 (A:1-83) UPF0237 protein SP0238 {Streptococcus pneumoniae [TaxId: 1313]} mkaiitvvgkdksgivagvsgkiaelglniddisqtvldeyftmmavvssdekqdftylr nefeafgqtlnvkiniqsaaife
Timeline for d1zpva1: