Lineage for d1zpsb_ (1zps B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2089469Fold b.168: HisI-like [141733] (1 superfamily)
    pseudo barrel, capped by an alpha-helix; contains a beta-triangle structure on one side; some topological similarity to the Ribosomal protein L25-like fold (50714) and the N-terminal domain of Glutamine synthetase (54368)
  4. 2089470Superfamily b.168.1: HisI-like [141734] (1 family) (S)
  5. 2089471Family b.168.1.1: HisI-like [141735] (1 protein)
    Pfam PF01502; PRA-CH; metalloenzyme, probable biological unit is dimeric
  6. 2089472Protein Phosphoribosyl-AMP cyclohydrolase HisI [141736] (1 species)
  7. 2089473Species Methanobacterium thermoautotrophicum [TaxId:145262] [141737] (1 PDB entry)
    Uniprot O26347 8-131
  8. 2089475Domain d1zpsb_: 1zps B: [125474]
    automated match to d1zpsa1
    complexed with acy, cd

Details for d1zpsb_

PDB Entry: 1zps (more details), 1.7 Å

PDB Description: Crystal structure of Methanobacterium thermoautotrophicum phosphoribosyl-AMP cyclohydrolase HisI
PDB Compounds: (B:) Phosphoribosyl-AMP cyclohydrolase

SCOPe Domain Sequences for d1zpsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zpsb_ b.168.1.1 (B:) Phosphoribosyl-AMP cyclohydrolase HisI {Methanobacterium thermoautotrophicum [TaxId: 145262]}
skgdvnillnfrhningedliiavaqdhetgevlmvaymnrealrrtletgtahywstsr
gklwlkgessghvqrvkdvlvdcdgdavvlkveqeggachtgyrscfyrsidgdelkvre
davkvfdp

SCOPe Domain Coordinates for d1zpsb_:

Click to download the PDB-style file with coordinates for d1zpsb_.
(The format of our PDB-style files is described here.)

Timeline for d1zpsb_: