SCOPe 2.08: Domain d1zpsb_: 1zps B:

Lineage for d1zpsb_ (1zps B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.168: HisI-like [141733] (1 superfamily)
   pseudo barrel, capped by an alpha-helix; contains a beta-triangle structure on one side; some topological similarity to the Ribosomal protein L25-like fold (50714) and the N-terminal domain of Glutamine synthetase (54368)

4. Superfamily b.168.1: HisI-like [141734] (1 family)

5. Family b.168.1.1: HisI-like [141735] (1 protein)
   Pfam PF01502; PRA-CH; metalloenzyme, probable biological unit is dimeric

6. Protein Phosphoribosyl-AMP cyclohydrolase HisI [141736] (1 species)

7. Species Methanobacterium thermoautotrophicum [TaxId:145262] [141737] (1 PDB entry)
   Uniprot O26347 8-131

8. Domain d1zpsb_: 1zps B: [125474]
   automated match to d1zpsa1
   complexed with acy, cd

Details for d1zpsb_

PDB Entry: 1zps, 1.7 Å

PDB Description: Crystal structure of Methanobacterium thermoautotrophicum phosphoribosyl-AMP cyclohydrolase HisI

PDB Compounds: (B:) Phosphoribosyl-AMP cyclohydrolase

SCOPe Domain Sequences for d1zpsb_:

Sequence; same for both SEQRES and ATOM records:

>d1zpsb_ b.168.1.1 (B:) Phosphoribosyl-AMP cyclohydrolase HisI {Methanobacterium thermoautotrophicum [TaxId: 145262]}
skgdvnillnfrhningedliiavaqdhetgevlmvaymnrealrrtletgtahywstsr
gklwlkgessghvqrvkdvlvdcdgdavvlkveqeggachtgyrscfyrsidgdelkvre
davkvfdp

Timeline for d1zpsb_:

• d1zpsb_ first appeared in SCOP 1.73, called d1zpsb1
  
• d1zpsb_ appears in SCOPe 2.07