SCOP 1.75: Domain d1zpqb1: 1zpq B:7-80

Lineage for d1zpqb1 (1zpq B:7-80)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (13 families)

5. Family a.35.1.9: Bacteriophage CII protein [140520] (1 protein)
   Pfam PF05269; a compact helix-swapped dimer of the canonical fold; includes the extra C-terminal teramerisation region (alpha-helix); in the tetramer-DNA complex only two of the four HTH motifs interact with DNA

6. Protein Regulatory protein cII [140521] (1 species)

7. Species Bacteriophage lambda [TaxId:10710] [140522] (3 PDB entries)
   Uniprot P03042 2-80! Uniprot P03042 4-81

8. Domain d1zpqb1: 1zpq B:7-80 [125470]
   automatically matched to 1XWR A:2-80

Details for d1zpqb1

PDB Entry: 1zpq, 2.8 Å

PDB Description: structure of bacteriophage lambda cii protein

PDB Compounds: (B:) Regulatory protein CII

SCOP Domain Sequences for d1zpqb1:

Sequence; same for both SEQRES and ATOM records:

>d1zpqb1 a.35.1.9 (B:7-80) Regulatory protein cII {Bacteriophage lambda [TaxId: 10710]}
rnealriesallnkiamlgtektaeavgvdksqisrwkrdwipkfsmllavlewgvvddd
marlarqvaailtn

Timeline for d1zpqb1:

• d1zpqb1 first appeared in SCOP 1.73
  
• d1zpqb1 is called d1zpqb_ in SCOPe 2.01
  
• d1zpqb1 appears in the current release, SCOPe 2.08, called d1zpqb_