Lineage for d1zpka_ (1zpk A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1796116Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 1796117Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 1796118Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 protein domains)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 1796134Protein Human immunodeficiency virus type 1 protease [50632] (8 species)
  7. 1796358Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (446 PDB entries)
    Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167
  8. 1796601Domain d1zpka_: 1zpk A: [125465]
    automated match to d1lzqa_
    complexed with 0zs, cl, na; mutant

Details for d1zpka_

PDB Entry: 1zpk (more details), 1.65 Å

PDB Description: crystal structure of the complex of mutant hiv-1 protease (a71v, v82t, i84v) with a hydroxyethylamine peptidomimetic inhibitor boc-phe-psi[r-ch(oh)ch2nh]-phe-glu-phe-nh2
PDB Compounds: (A:) protease retropepsin

SCOPe Domain Sequences for d1zpka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zpka_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qilieicghkvigtvlvgptptnvigrnlltqigctlnf

SCOPe Domain Coordinates for d1zpka_:

Click to download the PDB-style file with coordinates for d1zpka_.
(The format of our PDB-style files is described here.)

Timeline for d1zpka_: