Lineage for d1zpga1 (1zpg A:6-319)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 698273Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 698274Superfamily c.42.1: Arginase/deacetylase [52768] (2 families) (S)
  5. 698275Family c.42.1.1: Arginase-like amidino hydrolases [52769] (4 proteins)
    Pfam PF00491
  6. 698296Protein Arginase [52770] (5 species)
  7. 698346Species Rat (Rattus norvegicus) [TaxId:10116] [52771] (31 PDB entries)
  8. 698352Domain d1zpga1: 1zpg A:6-319 [125462]
    automatically matched to 1ZPE A:6-319
    complexed with bpe, mn; mutant

Details for d1zpga1

PDB Entry: 1zpg (more details), 1.9 Å

PDB Description: arginase i covalently modified with propylamine at q19c
PDB Compounds: (A:) arginase 1

SCOP Domain Sequences for d1zpga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zpga1 c.42.1.1 (A:6-319) Arginase {Rat (Rattus norvegicus) [TaxId: 10116]}
kpieiigapfskgcprggvekgpaalrkaglveklketeynvrdhgdlafvdvpndspfq
ivknprsvgkaneqlaavvaetqkngtisvvlggdhsmaigsisgharvhpdlaviwvda
htdintplttssgnlagqpvafllkelkgkfpdvpgfswvtpaisakdivyiglrdvdpg
ehyiiktlgikyfsmtevdklgigkvmeetfsyllgrkkrpihlsfdvdgldpvftpatg
tpvvgglsyreglyiteeiyktgllsgldimevnptlgktpeevtrtvntavaltlsafg
tkregnhkpetdyl

SCOP Domain Coordinates for d1zpga1:

Click to download the PDB-style file with coordinates for d1zpga1.
(The format of our PDB-style files is described here.)

Timeline for d1zpga1: