| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.153: Nuclear receptor coactivator interlocking domain [69124] (1 superfamily) 3 helices, non-globular array; forms interlocked heterodimers with its targets |
Superfamily a.153.1: Nuclear receptor coactivator interlocking domain [69125] (1 family) ![]() not a true superfamily |
| Family a.153.1.1: Nuclear receptor coactivator interlocking domain [69126] (4 proteins) |
| Protein automated matches [190180] (2 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [186918] (2 PDB entries) |
| Domain d1zoqd_: 1zoq D: [125454] automated match to d1kbhb_ |
PDB Entry: 1zoq (more details), 2.37 Å
SCOPe Domain Sequences for d1zoqd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zoqd_ a.153.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
salqdllrtlkspsspqqqqqvlnilksnpqlmaafikqrtakyvan
Timeline for d1zoqd_: