SCOPe 2.01: Domain d1zoqd_: 1zoq D:

Lineage for d1zoqd_ (1zoq D:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.153: Nuclear receptor coactivator interlocking domain [69124] (1 superfamily)
   3 helices, non-globular array; forms interlocked heterodimers with its targets

4. Superfamily a.153.1: Nuclear receptor coactivator interlocking domain [69125] (1 family)
   not a true superfamily

5. Family a.153.1.1: Nuclear receptor coactivator interlocking domain [69126] (4 proteins)

6. Protein automated matches [190180] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186918] (1 PDB entry)

8. Domain d1zoqd_: 1zoq D: [125454]
   automated match to d1kbhb_

Details for d1zoqd_

PDB Entry: 1zoq, 2.37 Å

PDB Description: IRF3-CBP complex

PDB Compounds: (D:) creb-binding protein

SCOPe Domain Sequences for d1zoqd_:

Sequence; same for both SEQRES and ATOM records:

>d1zoqd_ a.153.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
salqdllrtlkspsspqqqqqvlnilksnpqlmaafikqrtakyvan

Timeline for d1zoqd_:

• d1zoqd_ first appeared in SCOP 1.73, called d1zoqd1
  
• d1zoqd_ was called d1zoqd1 in SCOP 1.75
  
• d1zoqd_ appears in SCOPe 2.02
  
• d1zoqd_ appears in the current release, SCOPe 2.08